PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.031620.1
Common NameCsa_3G264750, LOC101206154
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 355aa    MW: 40502.2 Da    PI: 9.5974
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.031620.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-16453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++I+++m+  ++R +k+c +rw +yl
   Cucsa.031620.1  4 RQRWQPEEDALLRAYVKQYGPKEWNLISHRMPnpLHRDPKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding346.6e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ ++eE+ l + + +++G++ Wk+Ia++++ gRt+k +  +w  +
   Cucsa.031620.1  59 KGSLSPEEQSLVISLQAKYGNK-WKKIAAEVP-GRTPKRLGKWWEVF 103
                      57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.502157IPR017930Myb domain
SMARTSM007174.6E-15355IPR001005SANT/Myb domain
SuperFamilySSF466892.06E-22499IPR009057Homeodomain-like
CDDcd001671.34E-9653No hitNo description
Gene3DG3DSA:1.10.10.605.4E-21660IPR009057Homeodomain-like
PfamPF139214.9E-15769No hitNo description
PROSITE profilePS5129417.68458108IPR017930Myb domain
SMARTSM007178.5E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1561108IPR009057Homeodomain-like
CDDcd001675.13E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MKDRQRWQPE EDALLRAYVK QYGPKEWNLI SHRMPNPLHR DPKSCLERWK NYLKPGLKKG  60
SLSPEEQSLV ISLQAKYGNK WKKIAAEVPG RTPKRLGKWW EVFKEKQLKQ LHKANNLTQS  120
SLDPNLPISL AVSSPEKALQ GPYDHILETF AEKYVQPKLY PHPNSIPDAD PLLSLGSVTS  180
TTSSSTLLPL WMNVNSTSTA SSSTCSTTPS PSVSLTLSPS EPGCLESEVN RIGALVQYCK  240
EVEEGRQSWV QHKKEASWRL NRLEQQLESE KARKKREKME EMEAKIQRLR EEERVYLGGI  300
ERDYREQLNA LRREADCKEA KLVEDWCNKH SKLAKLVEKF GGHGLLGVSK DIVH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A7e-1611100995MYB3
3zqc_D7e-1611100995MYB3
3zqc_G7e-1611100995MYB3
3zqc_J7e-1611100995MYB3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1272277RKKREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818560.0LN681856.1 Cucumis melo genomic scaffold, anchoredscaffold00062.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011651362.10.0PREDICTED: transcription factor AS1-like
SwissprotO809312e-99AS1_ARATH; Transcription factor AS1
TrEMBLA0A0A0L7E60.0A0A0A0L7E6_CUCSA; Uncharacterized protein
STRINGVIT_14s0083g00120.t011e-141(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.13e-60MYB family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]